2.48 Rating by CuteStat

nutsbet.com is 9 years 8 months old. It is a domain having com extension. It has a global traffic rank of #1706074 in the world. This website is estimated worth of $ 480.00 and have a daily income of around $ 2.00. As no active threats were reported recently by users, nutsbet.com is SAFE to browse.

PageSpeed Score
49
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 282
Daily Pageviews: 564

Estimated Valuation

Income Per Day: $ 2.00
Estimated Worth: $ 480.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 1,706,074
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

88.198.176.106

Hosted Country:

Germany DE

Location Latitude:

51.2993

Location Longitude:

9.491
NUTSBET - World Gaming System

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 42
Google Adsense: Not Applicable Google Analytics: Not Applicable

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx/1.9.3 (Ubuntu)
Date: Sun, 04 Jun 2017 22:27:04 GMT
Content-Type: text/html;charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Content-Language: en
Strict-Transport-Security: max-age=31536000;
Content-Encoding: gzip

Domain Information

Domain Registrar: Pheenix, Inc.
Registration Date: Aug 20, 2014, 12:00 AM 9 years 8 months 2 weeks ago
Last Modified: Jan 17, 2017, 12:00 AM 7 years 3 months 2 weeks ago
Expiration Date: Aug 20, 2017, 12:00 AM 6 years 8 months 3 weeks ago
Domain Status:
clientDeleteProhibited
clientTransferProhibited

DNS Record Analysis

Host Type TTL Extra
nutsbet.com A 3590 IP: 88.198.176.106
nutsbet.com NS 3599 Target: ns2.sigcloud.ru
nutsbet.com NS 3599 Target: ns1.sigcloud.ru
nutsbet.com SOA 3599 MNAME: www.isp.sigcloud.ru
RNAME: nurkevich.nm.ru
Serial: 2016020959
Refresh: 3600
Retry: 3600
Expire: 604800
Minimum TTL: 86400
nutsbet.com MX 3599 Priority: 10
Target: mx.yandex.net
nutsbet.com TXT 3599 TXT: v=spf1 ip4:88.198.176.106
include:spf.unisender.com
include:_spf.yandex.net
ip4:88.198.176.104 -all
nutsbet.com TXT 3599 TXT: spf2.0/mfrom,pra
include:senderid.unisender.com
ip4:88.198.176.106 -all

Similarly Ranked Websites

Osborne Samuel - Modern and Contemporary Art - London Gallery

- osbornesamuel.com

OSBORNE SAMUEL GALLERY is one of London’s leading galleries, long established in the heart of Mayfair. The gallery began as Berkeley Square Gallery and became

1,706,077 $ 720.00

Carquest Auto Parts® - Canada - Francais and English

- carquest.ca

More than 300 auto parts stores throughout Canada, suppling the professional automotive service repair industry with replacement parts, tools and equipment.

1,706,077 $ 720.00

.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.

- srisubrahmanyaswamydevalayamskandagiri.org
1,706,079 $ 720.00

Home - Social Media Famous

- socialmediafamous.com

Find high-quality & affordable social media famous influncers that match your brand. Never deal with fake influencers again by using our real-time reporting on account growth history, engagement rate, average likes, comments, and more. Try it free today.

1,706,086 $ 720.00

Browse Instagram Influencers - Social Media Famous

- dash.socialmediafamous.com
1,706,086 $ 720.00